Description
Pre-made Lentivirus expressing human Kras gene mutant, KRas_G12V gene, under enhanced EF1a promoter. It’s amino acid sequence is listed below.
MteyklvvvgaVgvgksaltiqliqnhfvdeydptiedsyrkqvvidgetclldildtagqeeysamrdqymrtgegflcvf
ainntksfedihhyreqikrvkdsedvpmvlvgnkcdlpsrtvdtkqaqdlarsygipfietsaktrqgvddafytlvreir
khkekmskdgkkkkkksktkcvim*
It is used to immortalize some primary cell types. A GFP–Puromycin Fusion dual marker was expressed under RSV promoter, which allows to select the transduced cell via Blasticidin antibiotic or via cell sorting by RFP fluorescent signal.
It is used for cell immortalization and other application. See Product Manual (.pdf).
Amount: This is the concentrated lentivirus, provided in PBS solution as 200ul/per vial at 1 x 108 IFU/ml, best used for serum free cell culture, hard-to-infected cell types, or In Vivo application.
Cat#: LVP1139-GP-PBS
