Description
Pre-made Lentivirus expressing human Kras gene mutant, KRas_G12V gene, under enhanced EF1a promoter. It’s amino acid sequence is listed below.
MteyklvvvgaVgvgksaltiqliqnhfvdeydptiedsyrkqvvidgetclldildtagqeeysamrdqymrtgegflcvf
ainntksfedihhyreqikrvkdsedvpmvlvgnkcdlpsrtvdtkqaqdlarsygipfietsaktrqgvddafytlvreir
khkekmskdgkkkkkksktkcvim*
It is used to immortalize some primary cell types. A RFP-Blasticidin Fusion dual marker was expressed under RSV promoter, which allows to select the transduced cell via Blasticidin antibiotic or via cell sorting by RFP fluorescent signal.
It is used for cell immortalization and other application. See Product Manual (.pdf).
Amount: 200ul/per vial at 1 x 107 IFU/ml with 10x Polybrene (60 ug/ml)
Cat#: LVP1139-RB
